Как я могу получить кукурузная тортилья должна быть достаточно податливым, чтобы работать?

Я преподаю курс пишут, что есть много студентов, которые планируют изучать экономику и финансы в аспирантуре. Я не настолько знаком с этими дисциплинами, но хочу убедиться, что эти студенты закончить семестр с навыки, необходимые для успеха в аспирантуре. Какие письменные задания они могут ожидать?

+711
dok2 22 мар. 2010 г., 09:41:18
21 ответов

Я новичок в скриптах оболочки и я пытаюсь последовательно нумеровать заголовки в файл fasta. Последовательности в моих файлов fasta выглядеть так:

>Грызунов СП. 
MALWILLPLLALLILWGPDPAQAFVNQHLCGSHLVEALYILVCGERGFFYTPMSRREVED
PQVGQVELGAGPGAGSEQTLALEVARQARIVQQCTSGICSLYQENYCN

>Овис Овен
MALWTRLVPLLALLALWAPAPAHAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG
PQVGALELAGGPGAGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN

Я хочу использовать awk в моем shell-скрипт, так что заголовки будут автоматически пронумерованы, вставив номер, начиная от 1 до n (где n-количество последовательностей) после ">", Таким образом, что последовательности выглядят так:

> 1 грызунов СП. 
MALWILLPLLALLILWGPDPAQAFVNQHLCGSHLVEALYILVCGERGFFYTPMSRREVED
PQVGQVELGAGPGAGSEQTLALEVARQARIVQQCTSGICSLYQENYCN

> 2 Овис Овен
MALWTRLVPLLALLALWAPAPAHAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG
PQVGALELAGGPGAGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN

Я попытался с помощью функции суб в awk, чтобы сделать это, заменив по всему тексту слова ">" с "> [числа]".

на awk '/>/{подпункт(">", "> ++я ")}файл 1' 

Однако, я не понимаю, как прирастить переменных с помощью функции суб в awk. Я хотел бы знать, если есть способ сделать это с помощью функции суб. Я понимаю, что саб работает, но я не знаю, как объявить переменную, чтобы быть правильно увеличивается.

Я заявил, что я должен быть 1 в начале моего скрипта:

я=1

Однако, на выходе я получаю из функции подпрограммы:

> ++$я грызунов СП. 
> ++$я Овис Овен 

Как правильно объявить переменную, так что я могу использовать функцию на awk Sub на количество заголовков?

+977
MaryJoyce Agustin 03 февр. '09 в 4:24

терминология установлен (АПТ обновление + АПТ установить), и работает нормально в переходный 16.04 новой установки. Но при попытке отобразить картинку (или показать миниатюры изображений с tyls), он всегда выдает эту ошибку:

$ tycat Титан.ПНГ
Подстраховались<1714>:эмоции-универсальные модули/эмоции/общий/emotion_generic.с:1838 _players_load() нет универсальных игроков



$

затем пустое пространство-размер изображения, чтобы показать.

Пытался установить универсальные игроки, следуя этим инструкциям:

с wget http://download.enlightenment.org/rel/libs/emotion_generic_players/emotion_generic_players-1.17.0.tar.gz
тар-официального сайта emotion_generic_players-1.17.0.tar.gz
компакт-диск emotion_generic_players-1.17.0
./настройки-префикс=/usr
сделать
установка

но не получилось:

проверка на эмоции... нет
настроить: ошибка: пакет требований (эмоции >= 1.17) не были выполнены:

Нет пакет 'эмоции' нашли

Рассмотреть вопрос о корректировке переменной окружения PKG_CONFIG_PATH если вы установили программное обеспечение в нестандартный префикс.

Кроме того, вы можете установить переменные среды EMOTION_CFLAGS и EMOTION_LIBS, чтобы избежать необходимости вызова ПКГ-конфиг.
Увидеть ПКГ-конфиг страницу для более подробной информации.

Также установлен VLC плеер, только в случае, если это может понадобиться, но ничего не изменилось.

Обновление: подборка работал для версии 1.8.2 (emotion_generic_players-1.8.2):

------------------------------------------------------------------------
emotion_generic_players 1.8.2
------------------------------------------------------------------------

Параметры Конфигурации Резюме:
 Построить Профиль..........: Дэв

Игроки:
 В VLC....................: да

Сборник..............: сделать (или команде gmake)
 Добейтесь того,...............: 
 С CFLAGS.................: -г -О2
 CXXFLAGS...............: 
 LDFLAGS................: 

Установка.............: сделайте установите (как root, если это необходимо, с 'Су' или 'судо')
 префикс.................: /ЕГР
 эмоции универсальный игроки: в /usr/lib в/x86_64 с-линукс-дистрибутив GNU/эмоции/generic_players/Линукс-гну-архитектуру x86_64-1.8.6

но проблема остается после сделать и сделать установки: ЭРР<4002>:эмоции-универсальные модули/эмоции/общий/emotion_generic.с:1838 _players_load() нет универсальных игроков

+911
RANSARA009 9 мар. 2022 г., 08:45:22
Другие ответы

Связанные вопросы


Похожие вопросы

После возиться с ППД в попытке обновить Mesa драйверы под Линукс Минт 17.3 КДЕ на мой Lenovo устройства IdeaPad, мне удалось, казалось бы, привести все в рабочем состоянии. Теперь, однако, когда я попробуйте запустить программу на OpenGL, я получаю выход, как это:

$ glxgears
ошибка это libGL: разъем PCI ID для ФД 4: 8086:1916, водитель (нуль) 
i965_dri.так не поддерживает 0x1916 идентификатор шины PCI.
это libGL ошибка: не удалось создать Дри экран
ошибка это libGL: драйвер не удалось загрузить: i965

и при выходе, что-то вроде этого (или необычная обработка выхода онлайн / оффлайн, с моей Аллегро проекты):

XIO: неустранимая ошибка ввода-вывода 11 (ресурс временно недоступен) на X-сервер ":0"
 после 13936 запросы (13934 известно, обработан) с 0 остальных событий.

а программа, видимо, работает нормально. (За исключением, glxgears не больше, чтобы покрывать себя при 60 кадрах в секунду, которые он сделал раньше.)

Вот некоторые, надеюсь, соответствующие выход:

$ команду lspci | grep в ВГА
00:02.0 VGA совместимый контроллер: Intel корпорация Небесное озеро интегрированной графикой (Ред. 07)
$ команды dpkg -л | грэп-Меса
второй libegl1-Mesa в:для amd64 10.1.3-0ubuntu0.6 amd64 в свободной реализации API Эгль -- среда 
второй libegl1-Mesa в-Дэв 10.1.3-0ubuntu0.6 amd64 в свободной реализации компанией EGL API-интерфейс -- файлы разработки
второй libegl1-Меса-драйверы:для amd64 10.1.3-0ubuntu0.6 amd64 в свободной реализации ее по API -- драйверы 
libegl1-Mesa в-ЛЦ-яркий радиоуправляемый:для amd64 10.5.9-2ubuntu1~бесплатная trusty2 amd64, в реализации API Эгль -- среда
второй libgl1-Mesa в-Дэв 10.1.3-0ubuntu0.6 amd64 в свободной реализации на OpenGL API-интерфейс -- развитие ГБО файлов
второй libgl1-Mesa в-Дри:для amd64 10.1.3-0ubuntu0.6 для amd64 свободная реализация модулей с OpenGL API-интерфейс -- ДРИ 
радиоуправляемый libgl1-Mesa в-Дри-ЛЦ-яркие:amd64 в 10.5.9-2ubuntu1~trusty2 для amd64 свободная реализация поддержки OpenGL API-интерфейс -- ДРИ модулей
радиоуправляемый libgl1-Mesa в-Дри-ЛЦ-яркое:для i386 10.5.9-2ubuntu1~trusty2 для i386 свободная реализация поддержки OpenGL API с -- ДРИ модулей
второй libgl1-Mesa в-комплектации GLX:amd64 в 10.1.3-0ubuntu0.6 amd64 в свободной реализации на OpenGL API-интерфейс -- среда ГБО 
второй libgl1-Mesa в-комплектации GLX:i386 в 10.1.3-0ubuntu0.6 i386 в свободной реализации на OpenGL API-интерфейс -- среда ГБО 
libgl1-Mesa в-ГБО-ЛЦ-яркий радиоуправляемый:для amd64 10.5.9-2ubuntu1~бесплатная trusty2 amd64, в реализации поддержки OpenGL API-интерфейс -- среда ГБО 
libgl1-Mesa в-ГБО-ЛЦ-яркий радиоуправляемый:для i386 10.5.9-2ubuntu1~бесплатная trusty2 для i386 реализации на OpenGL API-интерфейс -- среда ГБО 
второй libglapi-Меса:для amd64 10.1.3-0ubuntu0.6 amd64 в свободной реализации, что GL по API -- общей библиотеки
второй libglapi-Меса:для i386 10.1.3-0ubuntu0.6 для i386 свободная реализация API для ГЛ -- общей библиотеки
радиоуправляемый libglapi-Меса-ЛЦ-яркое:для amd64 10.5.9-2ubuntu1~бесплатная trusty2 amd64, в реализации АПИ ГЛ -- общей библиотеки
радиоуправляемый libglapi-Меса-ЛЦ-яркое:для i386 10.5.9-2ubuntu1~бесплатная trusty2 для i386 реализации ГЛ АПИ -- общей библиотеки
libgles1-Меса-ЛЦ-яркий радиоуправляемый:для amd64 10.5.9-2ubuntu1~trusty2 для amd64 свободная реализация OpenGL в|Эс-1.х -- API для выполнения
второй libgles2-Меса:для amd64 10.1.3-0ubuntu0.6 amd64 в свободной реализации на OpenGL|Эс-2.х -- API для выполнения
второй libgles2-Меса-Дэв 10.1.3-0ubuntu0.6 amd64 в свободной реализации на OpenGL|Эс-2.х API-интерфейс -- файлы разработки
радиоуправляемый libgles2-Меса-ЛЦ-яркие:amd64 в 10.5.9-2ubuntu1~trusty2 для amd64 свободная реализация OpenGL в|Эс-2.х -- API для выполнения
второй libglu1-Mesa в:для amd64 9.0.0-2 amd64 в Месу в OpenGL Utility библиотека (Глю)
второй libglu1-Mesa в:для i386 9.0.0-2 для i386 Меса OpenGL в утилите библиотека (Глю)
второй libglu1-Меса-Дэв 9.0.0-2 amd64 в Месу в OpenGL Utility библиотека -- развитие файлов
второй libmirclientplatform-Меса:для amd64 0.1.8+14.04.20140411-0ubuntu1 для amd64 дисплей сервер для Ubuntu - библиотека клиентской платформы для Меса
второй libopenvg1-Меса:для amd64 10.1.3-0ubuntu0.6 для amd64 свободная реализация OpenVG по API -- среда
второй libwayland-egl1-Меса:для amd64 10.1.3-0ubuntu0.6 amd64, в реализации Платформы Вэйланд Эгль -- среда
libwayland-egl1-Меса-ЛЦ-яркий радиоуправляемый:для amd64 10.5.9-2ubuntu1~реализации trusty2 для amd64 платформы Вэйланд Эгль -- во время выполнения
второй Меса-общие-Дэв 10.1.3-0ubuntu0.6 amd64 в документации разработчика для Меса
второй Меса-utils версии 8.1.0-2 amd64 в разное Меса ГЛ коммунальные услуги

Редактировать: с помощью lspci -V и показывает, что "драйвер ядра В использовать" это "i915_bpo". Это должно быть вместо i965?

Редактировать: вот немного подчистил вывод glxinfo:

имя дисплея: :0
ошибка это libGL: разъем PCI ID для ФД 4: 8086:1916, водитель (нуль)
i965_dri.так не поддерживает 0x1916 идентификатор шины PCI.
это libGL ошибка: не удалось создать Дри экран
ошибка это libGL: драйвер не удалось загрузить: i965
дисплей: :0, экран: 0
прямой рендеринг: да
строка производитель ГБО: СГИ
сервер version строку ГБО: 1.4
расширения сервера ГБО:
...
клиент ГБО производитель: проект Mesa и СГИ
версия клиента строку ГБО: 1.4
расширения клиентской ГБО:
...
Версии GLX: 1.4
Расширения ГБО: 
...
Поддержка OpenGL производитель: компания VMware, Inc.в
OpenGL в строке Renderer: галлий 0.4 На для llvmpipe (LLVM с 3.4, 256 бит)
Версия OpenGL строку: 2.1 Меса 10.1.3
В OpenGL затенение язык строку Версия: 1.30
Расширения OpenGL:
...

Редактировать: вот некоторые форматированный вывод inxi:

$ inxi -ги
Графика: 
Карта: Интел Небо Озеро Интегрированной Графикой
Сервер отображения: X.Org драйверы 1.15.1: процессор Intel (расгруженное: и fbdev,VESA до)
Разрешение: [email protected]
Рендерер ГБО: галлий 0.4 На для llvmpipe (LLVM с 3.4, 256 бит) 
Версии GLX: 2.1 Меса 10.1.3

Редактировать: более соответствующих выходных

$ lsmod распечатывает | команда grep 'i9 не' 
i915_bpo 1138688 3 
intel_ips 20480 1 i915_bpo
i2c_algo_bit 16384 1 i915_bpo
drm_kms_helper 126976 1 i915_bpo
ЦУП 344064 4 i915_bpo,drm_kms_helper
видео 20480 1 i915_bpo

$ modinfo i915_bpo
имя файла: /Либ/модули/3.19.0-32-общий/ядра/Убунту/i915/i915_bpo.ко
лицензия: GPL и дополнительные права
описание: встроенная графика Intel
автор: корпорация Intel
автор: Вольфрам графики, Инк.
прошивка: i915/skl_dmc_ver1.Бен
srcversion: 55E14C24236445DE1BF5F67

Редактировать: практически каждый ГЛ-обзоры приложений работает некорректно в некоторых путь или другой, GIMP, особенно. Это точно не драйвера, у меня была раньше. ППА-продувка тоже было бесполезно, хотя я уже давно удалены вручную ППА файлов.

+909
user301333 17 авг. 2015 г., 04:07:53

Наверное, это вопрос лучше всего подходит для форумов поддержки Apple, но после выяснения вариантов этого вопроса есть безрезультатно, попробую сюда.

У меня 2012/2013 2.3 ГГц i7 с МАК мини Ж/ 16 ГБ, что за 4-5 лет я владел ею (так как новая) и побежал в 4 версиях OS Х/macOS и красиво и эффективно. С другой стороны, у меня 2015 МасВоок Pro 13" i7 то я восстановил ОС с нуля два раза и продолжает быть свиньей (под управлением той же программы) и не дает покоя каждый-настоящее 1-2 ГБ ядра процесс-загадка, который сидит в верхней части памяти и процессора монитора в значительной степени все время. Я читал блоги на эту вершину предполагая, выдергивая ядра расширения, но, честно говоря, я никогда не пытался что песчаный поскольку даже плакат сообщает блог даже сказал, что это было довольно много черной магии и Вы были в основном выбираю вещи, не много с бухты-барахты. Кексты были просто "есть и ненужное" от "устаревших платформ" и занимают ресурсы. Это звучало правильно, но подход, похоже, так волей-неволей я никогда не был на борту.

В любом случае, я отказался от этого лет назад и у меня было довольно много, просто принято считать, что мой MacBook был свиньей и удалось, потому что по крайней мере мой мини был яркий и чистый, и был в течение всей его жизни. То есть до вчерашнего дня, где он сейчас в основном такие же корявые свинью, как мой ПМБ. Единственное что изменил бы, что я был самое последнее обновление. Самое странное ПМБ работает высокая Сьерра, где мой доселе незыблемую мини по-прежнему в Сьерра, но у них сейчас такое же жалкое представление. Я понятия не имею, если это не имеет ничего общего с недавним шторм патчи подтолкнул в целом, или только один, или что-то совсем другое, но когда я пришел, чтобы найти мой старый, но надежный (и быстрый) Mini теперь имеет "оспа" я был в раздрае.

Кто-нибудь каждый добрался до сути этой досадной "процесс ядра" проблема, когда кажется, что все действия пользователей на процессор, похоже, форс-умножается по непонятным причинам, которые просто сделать компьютер свиньи все вокруг? Я попросил Apple об этом и я вам эквивалент плечами. Я до этого момента только предполагал, что мой МБП был просто уступает машина мини, так как она по-прежнему медленно и несчастным даже после полного переформатировать и переустановить, но теперь, когда мой мини-отравлен я вижу, что это явно сложнее, что как неделю назад был мини-безупречная машина, как это было в течение 4-5 лет (удивительно для компьютера так долго, да) и теперь, совершенно неожиданно, больно использовать, и верный признак того, что вражьи раздутый процесс ядра, который горит электричество, даже если компьютер находится в буквальном смысле ничего не делая.

Если у вас есть опыт изгнания этого конкретного демона, я был бы очень заинтересован в том, что вы должны сказать, потому что я даже не знаю с чего начать. Я на этот квест в течение многих лет и в основном отказались считая потери, но сдаваться два компьютера к этому Раку просто чувствует себя неприемлемым. Чтобы начать все заново пришлось бы начинать заново, и я действительно ненавижу, даже не думая тратить столько времени впустую.

Спасибо заранее.

Обновление 1/31/18: Поскольку этот вопрос является очень старой проблемой, которая просто поднимает свою уродливую голову где-то я никогда не думал, что это было, похоже, что есть много примеров статей, которые пытаются решить эту проблему. Пока я не читала ничего, что дает мне много новой информации, это еще проверить, что это на самом деле известная проблема, но она может быть симптомом любого количества вопросов. Один из них даже ссылки в блоге статью я нашел ранее об удалении ненужных Яблоко Кексты, что рудиментарны/обременение/проблематично, но вы должны делать это на свой страх и риск. У меня еще есть ощущение, что "этого не может быть" и "ты преувеличиваешь" и что либо (1) что-то там еще происходит вот что гораздо более простое объяснение или (2) существует глубокая проблема, которая затрагивает само ядро операционной системы macOS ручки управления ресурсами, что слишком трудно решить с высокими инженеров, кто посмеет тронуть кода ядра в Apple, и слишком необычные, чтобы сделать его стоит возиться с, и, следовательно, остается игнорировать слона в чужой номер. Я очень надеюсь, что это (1).

Кроме того, я проверил вывод команды kextstat и только сторонние Кексты для VirtualBox, которые я использую для дольше, чем я владел компьютером и не обновляется годами (я думаю может быть хорошим или плохим), поэтому, если изменение произошло в macOS, что вдруг не играет хорошо с эти Кексты, это скорее всего не проблема. Конечно, не исключаю, что проблема КЕКСТ-обзоры.

Я предполагаю, что это сводится к тому, что мероприятия, необходимые для выявления этой проблемы невероятно трудоемкой, а в это потребуется несколько дней, чтобы сделать итерационный поиск и устранение неисправностей, необходимые для определения оскорбительный вопрос. Это отчасти потому, что саму проблему это туманное, можно сказать, субъективные - так что с точки зрения качества нет да/нет проверить.

Я предполагаю, что я всегда мог просто уволит его и начать с новой установки на отформатированный жесткий диск, но тогда тайна останется тайной и, основываясь на предыдущем опыте на моем MacBook Pro, а затем я ожидаю, что проблема все равно вернется. Единственный способ застраховаться от того, что бы получать вещи чистые и регулярно загрузку с USB и ДД, если=/dev/diskWhatever о=/путь/к/огромные/суммы/на/резервного/космос, главное до и после любая система обновления любого рода. Конечно, это будет чрезвычайно утомительно и в этот момент я хотел отказаться, сказать, Достаточно, достаточно, и пользуетесь Linux.

Обновление 3/5/18 Я знаю, что это добраться до точки закрываются, но у меня есть еще один интересный доклад. В итоге я жарю с MBP 13”с SSD, когда я пролил воду на клавиатуру и она пыжится замены батареи на Apple, ни копейки, и это в принципе есть бесплатные moboard, экран (там был помню) и с SSD, который был на гарантии, это в основном новый компьютер. Я сделал ТМ восстановления на новый ССД (который восстанавливает машина в таком же состоянии как последнего резервного копирования, бородавки и все) и это супер быстрый с ядром процесса и window_manager работает на тихих уровнях, поэтому я уверен, что проблема была в оборудовании все вместе. Это означает, что мой мини может страдать от какого-то оборудования грусть, а может и нет. Я собираюсь перестроить его и увидеть. Это никогда не было так как я купил его 5 лет назад (всегда так делал “апгрейд”) так это, наверное, из-за!

+712
Mutiscom Arafat 18 янв. 2016 г., 05:19:59

Используйте толстый кокосовое молоко (как 'выбор' бренд шеф-повара). Дешевле бренды менее густой, и только имея больше воды.

Толще кокосовое молоко также является более интенсивным вкусом (в том числе слаще).

+704
hareesh 7 окт. 2011 г., 15:22:51

в /etc/systemd в/система/объем.услуги

Это моя первая попытка создать блок файла.

[Блок]
Описание="установить уровень громкости."
После=звука.цель

[Услуги]
Тип=простой
ExecStart='/usr/Бен/amixer sset ПКМ -- 97%'

[Установите]
WantedBy=Multi-потребителя.цель

Мне пришлось обновлять блок файлы

systemctl демон-перезагрузка

Я попытался запустить громкости.услуги

объем systemctl начать 

journalctl -Хе раскрывает:

systemd в[1855]: объем.служба: ошибка на шаге нереста метод exec /usr/Бен/amixer sset ПКМ -- 97%: нет такого файла или каталога
+685
Dephi Kennerly 24 сент. 2016 г., 11:05:09

Чтобы скрыть значки на рабочем столе, выполните следующие команды в терминале:

по умолчанию запись com.яблоко.CreateDesktop -bool и искатель ложные
команду killall Finder в

Чтобы снова показать их, выполнить:

по умолчанию запись com.яблоко.CreateDesktop -bool и искатель истинного
команду killall Finder в

Источник: скрыть все значки на рабочем столе в Mac OS Х.

+665
user203598 28 янв. 2018 г., 21:40:49

В связи с этим вопрос:

Наблюдая за поведением fatrace, я замечаю то, что меня беспокоит. Вот первые несколько строк вывода команды "fatrace|грэп терминал"

терминал(4112): о каталоге /etc/passwd с
терминал(4112): участие в /etc/passwd с
терминал(4112): с файл /etc/passwd с
терминал(4112): о каталоге /etc/passwd с
терминал(4112): с файл /etc/passwd с
терминал(4112): о каталоге /etc/passwd с
терминал(4112): с файл /etc/passwd с
терминал(4112): о каталоге /etc/passwd с
терминал(4112): с файл /etc/passwd с
терминал(4112): о каталоге /etc/passwd с
терминал(4112): с файл /etc/passwd с
терминал(4112): о каталоге /etc/passwd с
терминал(4112): с файл /etc/passwd с
терминал(4112): о каталоге /etc/passwd с
терминал(4112): с файл /etc/passwd с
терминал(4112): о каталоге /etc/passwd с
...

Дело в том, что lsof|grep в файл passwd показывает, что пароль не открыт каким-либо процессом.

Поэтому любая идея, что происходит?

+557
kamilla 30 окт. 2010 г., 02:49:51

Как всегда - это зависит. Большинство мониторинг-инструмент станет желтой или красной, они сталкиваются с более чем определенное количество зомби процессов.

Так что по сути - да - это обычно признак проблемы.

Но я видел программы, которые наплодили зомби-процессов в рамках их "обычных" операций. Эти зомби-процессы ушли, когда по верхнего уровня-API-интерфейс (я не говорю здесь родительский процесс) получил название "команду QUIT/выход".

Поэтому в этих случаях кажется, что приложение позаботился (и возможно нужно) эти зомби. Поэтому для контроля я должен был указать исключение на серверах, где эти приложения были запущены.

В остальных случаях зомби ушел после короткого времени, так что вы можете иметь определенные непостоянные-система государств с зомби-процессов.

В вашем случае: если GVim выступает сделано, не должно быть никаких зомби слева - так, вероятно, ошибка.

+529
Marquise Blair 6 авг. 2017 г., 07:49:36

На конференциях, которые я посещаю, учебники стремятся быть своего рода устный опрос по теме, представляя практиков (молодой или старый) в единое тело работы, вероятно, будут представлять для них интерес. Например, человек может дать развернутый ", как" введение в новый (или недавно импортированных) набор методов, которые многие люди заинтересованы в подаче заявки, или могут представлять собой целостную картину значимых результатов в подполе.

+524
user3278574 26 июл. 2016 г., 13:17:10

Так у меня недавно интересный на наш местный выиграть турнир по боксу.

Сцена - у меня осталось 12 жизнь, мой оппонент 9. У меня ООН-чудовищный Колосс Арбор и Polukranos, Пожиратель мира(чудовищный 4), мой противник не имеет никакого правления, кроме Земли.

Это моя очередь, я атакую оба моих существа. Мой оппонент разыгрывает Титан сила на моей Polukranos, а потом бросает Отклоняя ладони на Polukranos так что я теперь мертва для моих собственных Polukranos (12/12).

Игра закончилась здесь, потому что мой оппонент начал кричать так громко о том, как он выиграл с такой игрой, что я пропустил важнейшую часть доски.

Я мог бы использовать чудовищную способность на мой Арбор Колос и сделал, что 9/9. Поэтому у меня вопрос:-

Если бы я использовал мой чудовищный на беседку Колос - это сделало бы игру вничью (мы оба умрем одновременно) или может у меня есть существа наносят повреждения в порядок мой выбор, и таким образом выиграть игру, прежде чем быть убитым своими Polukranos??

+451
whatkai 30 нояб. 2013 г., 14:00:32

Я пытался корня моем HTC желание 826W, но он не работает . Я не мог получить знак. Когда я загрузить мой телефон в загрузчик, загружается в hboot, но когда я пытаюсь ввести быстрой загрузки или восстановления он входит в белый экран и возвращается в hboot. Когда я снова нажмите кнопку питания, он перезагружается. Когда я нажимаю Громкость вверх, я могу только перемещаться с помощью громкости. Это действительно неприятно, я был бы признателен, если кто-то может помочь. Безопасность на меня.е-на

+450
A L 20 апр. 2020 г., 05:05:05

Количество облучения, которую вы получите от лечения Раи мало - статистически безопасный, но все-таки ничтожно мало (и уж точно безопаснее, чем не лечиться). Сохраняя дистанцию от других людей в течение нескольких дней вы гарантировать 100%, что это излучение не причинит вреда им (как ни мала вероятность).

+411
Sanyok 13 апр. 2011 г., 06:35:08

RSS-канал будет не Swapable объем памяти, это не считается свободной памяти.это часть используемой памяти. И не забудьте про ВСЗ ведьма колонка дает вам количество памяти, занимаемой процессом.

+339
Nathan BeDell 9 мар. 2023 г., 21:04:53

Один инструмент может удовлетворить ваши потребности является tshark:

$ tshark -Q-я для eth0 -продолжительность:86400 -з усл,IP сетчатый 192.168.122.0/25

С:

  • -вопрос: не показывать постоянное число пакетов в плен
  • -я интерфейс eth0: захват трафика на интерфейсе eth0 в (в качестве альтернативы вы можете также использовать для захвата трафика на всех интерфейсах)
  • -продолжительность:86400 : захват трафика на день
  • -з усл пользователя,IP : получить IP-адрес статистики
  • чистая 192.168.122.0/25 : захвата фильтра

Пример вывода:

$ tshark -м -я -продолжительность:10 -з усл,ИП продажи 192.168.134.0/24
 | <- | | -> | | Общая | Относительная | Продолжительность |
 | Кадров Байт | | Кадров Байт | | Кадров Байт | Начала | |

151.101.122.217 <-> 192.168.134.142 571 43915 591 3186555 1162 3230470 0,994980222 6,3748
192.168.134.142 <-> 192.168.136.27 5 1347 6 788 11 2135 5,714866377 0,0350
192.168.134.96 <-> 192.168.134.255 0 0 10 1060 10 1060 0,000000000 9,1583
151.101.129.69 <-> 192.168.134.142 5 608 5 632 10 1240 6,193916779 0,1324

Оттуда, в зависимости от ваших потребностей, вы можете использовать другие инструменты командной строки для анализа производства и сумма байтов (например, программисты)

+275
Noman Aslam 3 июн. 2015 г., 09:01:14

Другая возможность meetup.com. Здесь, в Ванкувере, по крайней мере, есть несколько туристических групп, и многие из них расписание поездок вместе.

Вы также можете попробовать Одинокая Планета Thorntree форумы, и узнать, кто еще едет в том же районе, или даже выставлен пост существует для людей, чтобы присоединиться к вам. Это довольно часто можно увидеть, что там.

+232
Doctor Know 21 июн. 2015 г., 11:43:59

Вы говорите, что вы были в состоянии сделать на уровне пользователей доступ к рабочим. Для меня это звучит как это всего лишь настройки самбы, что это неправильно. В былые времена, я бы сказал ясно из Самбу.conf и сделать простой тот, который соответствует вашим потребностям, правильное Самбу.conf не должны быть более 10 строк, может быть.

В любом случае, что-то простое решение возникло: система-конфигурация-Самбу установить

судо apt-получить системные-настройка-Самба установить

Прежде чем вы начнете, вы могли бы сбросить Самбу.Conf в исходное состояние. Чтобы убедиться, что никаких "скрытых" синтаксические ошибки пробраться свой путь в течение всех неполадок

Панель управления достаточно проста:

  • нажмите на знак '+'
  • выберите каталог
  • сделать видимым (и писать?)
  • перейдите к вкладке "Доступ"
  • выберите 'Разрешить доступ к любому

Альтернативный (и чуть более правильный) способ сделать это:

  • создать *по имени пользователя шухер: гость (или как угодно)
    • по соображениям безопасности, убедитесь, что "гость" имеет /ОГРН/ложь в качестве регистрационной оболочки (если вы не хотите, чтобы оценки, чтобы иметь возможность входа в систему через SSH и т. д. как хорошо)
  • в "Настройки" меню: выберите "Самба пользователи"
  • убедитесь, что "гость" в списке: если не создать его.

тогда

  • в "Настройки" меню: выберите "настройки сервера"
  • На вкладке "Безопасность": от "гостевой аккаунт", выберите "гость"

Теперь любой, кто пытается войти анонимно будет назначена пользователю "гость", и, следовательно, будет иметь все права "гость" был.

  • теперь создать общую папку, как описано ранее, только вместо выбора "разрешить доступ всем", просто выберите "гость".

убедитесь, что *Никс пользователя "гость" имеет достаточно прав на чтение и/или запись в общую папку.

Удачи!

/В2С

+170
paul23 4 янв. 2023 г., 19:49:46

Я хотел бы создать ГНУ экран на моем окне безголовый CentOS в такой, что когда начинается с экранов уже выполняется.

Мой .bashrc и файл работает экран на первом входе с экрана -xRR и я хотел бы Кроме и различные журналы, чтобы быть автоматически открыт.

Это также можно присваивать названия экранах одновременно?

+102
Vincent C 18 апр. 2017 г., 07:46:31

Я хотел бы записать вывод программы с установщика с помощью командной строки/баш скрипт. Важно не записывать всех выходной, но только выход из одной конкретной программы.

Я думал, что придется создавать новый нуль-раковина и чем перенести выход программы в этой новой раковины. Чем сказать parec для использования этого конкретного монитора для записи.

Первым шагом будет что-то вроде этого:

нагрузка-модуль pactl модуль-нуль-раковина sink_name=пара

Но как перенести выход программы теперь эта раковина?
И как записать конкретные раковина с bash-скрипт?

+91
user33375 1 окт. 2014 г., 13:21:52

Есть ли рекомендуемый способ очистить миниатюру данные, которые у меня в папку DCIM/.эскизы папок?

Он занимает около 50 МБ, и я хочу, чтобы очистить его, но когда я нажимаю Ctrl+A в окне Проводника Windows перестает отвечать на запросы. Там может быть 10 000 файлов в каталоге.

Этого достаточно, чтобы вызвать проблемы, когда проводник просто зависает?

Я читал в другом посте здесь на АЭ, что ты должен зайти в Настройки Приложения, а затем выберите приложение Галерея и нажмите кнопку Очистить кэш.

Я попытался это и он не помог. Также он говорит в диалоге, что площадь занимали около 170 КБ или около того. Так что я не думаю, что это он.

Но это на Android 2.2, просто для галочки, так что, возможно, он не работает в этой версии.

+30
yoder 17 мар. 2020 г., 05:26:47

Я пытаюсь получить доступ к информации бумажник, используя следующие blockchain.info API-интерфейс. https://github.com/blockchain/api-v1-client-node/tree/master/MyWallet

Однако, есть разница для каждого WalletID в extendedPrivateKey к вам.

Образец □ счет - ー ー ー ー
 ID БУМАЖНИК: *********
 ОСНОВНОЙ ПЕРЕВАЛ: *********
 Открытый ключ получается с listXPubs:
xpub****************

 От открытый ключ выше, extendedPrivateKey полученных с getAccount:
xprv****************
 ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー
Образец счета □ Б - ー ー ー ー ー ー
 ID БУМАЖНИК: *********
 ОСНОВНОЙ ПЕРЕВАЛ: *********
 Открытый ключ получается с listXPubs:
xpub****************

От открытый ключ выше, extendedPrivateKey полученных с getAccount:
 *********************/*******************/****************** + *********************** =
 ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー ー

Как ожидается, стоимость extendedPrivateKey, я думаю, что он представляет собой строку символов, начиная с xprv.

Поэтому, пожалуйста, дайте мне проверить 2 очка.

  • Подтверждение 1, является значением, возвращенным образец счет правильной как extendedPrivateKey?
  • Есть ли способ, чтобы получить строку символов, начиная с xprv с подтверждением 2, образец счета Б
+22
user251714 9 окт. 2011 г., 13:53:18

Показать вопросы с тегом